Anti NES pAb (ATL-HPA026111 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026111-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: NES
Alternative Gene Name: FLJ21841
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004891: 49%, ENSRNOG00000018681: 55%
Entrez Gene ID: 10763
Uniprot ID: P48681
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EPLRSLEDENKEAFRSLEKENQEPLKTLEEEDQSIVRPLETENHKSLRSLEEQDQETLRTLEKETQQRRRSLGEQDQMTLRPPEKVDLEPLKSLDQEIARPLENENQEFLKSLKEESVEAVKSLETEILESLKSAGQENLETLK |
| Gene Sequence | EPLRSLEDENKEAFRSLEKENQEPLKTLEEEDQSIVRPLETENHKSLRSLEEQDQETLRTLEKETQQRRRSLGEQDQMTLRPPEKVDLEPLKSLDQEIARPLENENQEFLKSLKEESVEAVKSLETEILESLKSAGQENLETLK |
| Gene ID - Mouse | ENSMUSG00000004891 |
| Gene ID - Rat | ENSRNOG00000018681 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NES pAb (ATL-HPA026111 w/enhanced validation) | |
| Datasheet | Anti NES pAb (ATL-HPA026111 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NES pAb (ATL-HPA026111 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti NES pAb (ATL-HPA026111 w/enhanced validation) | |
| Datasheet | Anti NES pAb (ATL-HPA026111 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NES pAb (ATL-HPA026111 w/enhanced validation) |
| Citations for Anti NES pAb (ATL-HPA026111 w/enhanced validation) – 3 Found |
| Riva, Matteo; Wouters, Roxanne; Weerasekera, Akila; Belderbos, Sarah; Nittner, David; Thal, Dietmar R; Baert, Thaïs; Giovannoni, Roberto; Gsell, Willy; Himmelreich, Uwe; Van Ranst, Marc; Coosemans, An. CT-2A neurospheres-derived high-grade glioma in mice: a new model to address tumor stem cells and immunosuppression. Biology Open. 2019;8(9) PubMed |
| Signorelli, Mirko; Ayoglu, Burcu; Johansson, Camilla; Lochmüller, Hanns; Straub, Volker; Muntoni, Francesco; Niks, Erik; Tsonaka, Roula; Persson, Anja; Aartsma-Rus, Annemieke; Nilsson, Peter; Al-Khalili Szigyarto, Cristina; Spitali, Pietro. Longitudinal serum biomarker screening identifies malate dehydrogenase 2 as candidate prognostic biomarker for Duchenne muscular dystrophy. Journal Of Cachexia, Sarcopenia And Muscle. 2020;11(2):505-517. PubMed |
| Corell, Alba; Gómez Vecchio, Tomás; Ferreyra Vega, Sandra; Dénes, Anna; Neimantaite, Alice; Hagerius, Alexander; Barchéus, Hanna; Solheim, Ole; Lindskog, Cecilia; Bontell, Thomas Olsson; Carén, Helena; Jakola, Asgeir S; Smits, Anja. Stemness and clinical features in relation to the subventricular zone in diffuse lower-grade glioma: an exploratory study. Neuro-Oncology Advances. 2022;4(1):vdac074. PubMed |