Anti NES pAb (ATL-HPA006286)

Atlas Antibodies

Catalog No.: ATL-HPA006286-25

Protein Description: nestin
Gene Name: NES
Alternative Gene Name: FLJ21841
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004891: 47%, ENSRNOG00000018681: 42%
Entrez Gene ID: 10763
Uniprot ID: P48681
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DPEGQSQQVGAPGLQAPQGLPEAIEPLVEDDVAPGGDQASPEVMLGSEPAMGESAAGAEPGPGQGVGGLGDPGHLTREEVMEPPLEEESLEAKRVQGLEGPRKDLEEAGGLGTEFSELP
• Gene Sequence: DPEGQSQQVGAPGLQAPQGLPEAIEPLVEDDVAPGGDQASPEVMLGSEPAMGESAAGAEPGPGQGVGGLGDPGHLTREEVMEPPLEEESLEAKRVQGLEGPRKDLEEAGGLGTEFSELP
• Gene ID - Mouse: ENSMUSG00000004891
• Gene ID - Rat: ENSRNOG00000018681
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NES pAb (ATL-HPA006286) – 1 Found

Signorelli, Mirko; Ayoglu, Burcu; Johansson, Camilla; Lochmüller, Hanns; Straub, Volker; Muntoni, Francesco; Niks, Erik; Tsonaka, Roula; Persson, Anja; Aartsma-Rus, Annemieke; Nilsson, Peter; Al-Khalili Szigyarto, Cristina; Spitali, Pietro. Longitudinal serum biomarker screening identifies malate dehydrogenase 2 as candidate prognostic biomarker for Duchenne muscular dystrophy. Journal Of Cachexia, Sarcopenia And Muscle. 2020;11(2):505-517.