Anti NEMP2 pAb (ATL-HPA057719)

Atlas Antibodies

Catalog No.:
ATL-HPA057719-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: nuclear envelope integral membrane protein 2
Gene Name: NEMP2
Alternative Gene Name: TMEM194B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043015: 71%, ENSRNOG00000012924: 71%
Entrez Gene ID: 100131211
Uniprot ID: A6NFY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SWSLHYPLRACSYMRWKMEQWFTSKELVVKYLTEDEYREQADAETNSALEELRRACRKPDFPSWLVVSRLHTPSKFADFVLGGSHLSPEEI
Gene Sequence SWSLHYPLRACSYMRWKMEQWFTSKELVVKYLTEDEYREQADAETNSALEELRRACRKPDFPSWLVVSRLHTPSKFADFVLGGSHLSPEEI
Gene ID - Mouse ENSMUSG00000043015
Gene ID - Rat ENSRNOG00000012924
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NEMP2 pAb (ATL-HPA057719)
Datasheet Anti NEMP2 pAb (ATL-HPA057719) Datasheet (External Link)
Vendor Page Anti NEMP2 pAb (ATL-HPA057719) at Atlas Antibodies

Documents & Links for Anti NEMP2 pAb (ATL-HPA057719)
Datasheet Anti NEMP2 pAb (ATL-HPA057719) Datasheet (External Link)
Vendor Page Anti NEMP2 pAb (ATL-HPA057719)