Anti NEMP2 pAb (ATL-HPA057719)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057719-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NEMP2
Alternative Gene Name: TMEM194B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043015: 71%, ENSRNOG00000012924: 71%
Entrez Gene ID: 100131211
Uniprot ID: A6NFY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SWSLHYPLRACSYMRWKMEQWFTSKELVVKYLTEDEYREQADAETNSALEELRRACRKPDFPSWLVVSRLHTPSKFADFVLGGSHLSPEEI |
| Gene Sequence | SWSLHYPLRACSYMRWKMEQWFTSKELVVKYLTEDEYREQADAETNSALEELRRACRKPDFPSWLVVSRLHTPSKFADFVLGGSHLSPEEI |
| Gene ID - Mouse | ENSMUSG00000043015 |
| Gene ID - Rat | ENSRNOG00000012924 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NEMP2 pAb (ATL-HPA057719) | |
| Datasheet | Anti NEMP2 pAb (ATL-HPA057719) Datasheet (External Link) |
| Vendor Page | Anti NEMP2 pAb (ATL-HPA057719) at Atlas Antibodies |
| Documents & Links for Anti NEMP2 pAb (ATL-HPA057719) | |
| Datasheet | Anti NEMP2 pAb (ATL-HPA057719) Datasheet (External Link) |
| Vendor Page | Anti NEMP2 pAb (ATL-HPA057719) |