Anti NELL2 pAb (ATL-HPA035715)

Atlas Antibodies

Catalog No.: ATL-HPA035715-25

Protein Description: NEL-like 2 (chicken)
Gene Name: NELL2
Alternative Gene Name: NRP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022454: 90%, ENSRNOG00000006235: 90%
Entrez Gene ID: 4753
Uniprot ID: Q99435
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDFCSERHNCMENSICRNLNDRAVCSCRDGFRALR
• Gene Sequence: SSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDFCSERHNCMENSICRNLNDRAVCSCRDGFRALR
• Gene ID - Mouse: ENSMUSG00000022454
• Gene ID - Rat: ENSRNOG00000006235
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NELL2 pAb (ATL-HPA035715) – 2 Found

Cao, Aili; Li, Jianhua; Asadi, Morad; Basgen, John M; Zhu, Bingbing; Yi, Zhengzi; Jiang, Song; Doke, Tomohito; El Shamy, Osama; Patel, Niralee; Cravedi, Paolo; Azeloglu, Evren U; Campbell, Kirk N; Menon, Madhav; Coca, Steve; Zhang, Weijia; Wang, Hao; Zen, Ke; Liu, Zhihong; Murphy, Barbara; He, John C; D'Agati, Vivette D; Susztak, Katalin; Kaufman, Lewis. DACH1 protects podocytes from experimental diabetic injury and modulates PTIP-H3K4Me3 activity. The Journal Of Clinical Investigation. 2021;131(10) 

Nakamura, Ritsuko; Oyama, Takeru; Tajiri, Ryosuke; Mizokami, Atsushi; Namiki, Mikio; Nakamoto, Masaru; Ooi, Akishi. Expression and regulatory effects on cancer cell behavior of NELL1 and NELL2 in human renal cell carcinoma. Cancer Science. 2015;106(5):656-64.