Anti NELL2 pAb (ATL-HPA035714)

Atlas Antibodies

Catalog No.:
ATL-HPA035714-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: neural EGFL like 2
Gene Name: NELL2
Alternative Gene Name: NRP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022454: 89%, ENSRNOG00000006235: 90%
Entrez Gene ID: 4753
Uniprot ID: Q99435
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CYCERTCTMKGTTYREFESWIDGCKNCTCLNGTIQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTV
Gene Sequence CYCERTCTMKGTTYREFESWIDGCKNCTCLNGTIQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTV
Gene ID - Mouse ENSMUSG00000022454
Gene ID - Rat ENSRNOG00000006235
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NELL2 pAb (ATL-HPA035714)
Datasheet Anti NELL2 pAb (ATL-HPA035714) Datasheet (External Link)
Vendor Page Anti NELL2 pAb (ATL-HPA035714) at Atlas Antibodies

Documents & Links for Anti NELL2 pAb (ATL-HPA035714)
Datasheet Anti NELL2 pAb (ATL-HPA035714) Datasheet (External Link)
Vendor Page Anti NELL2 pAb (ATL-HPA035714)