Anti NELL1 pAb (ATL-HPA051535)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051535-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: NELL1
Alternative Gene Name: FLJ45906, IDH3GL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055409: 96%, ENSRNOG00000015675: 95%
Entrez Gene ID: 4745
Uniprot ID: Q92832
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CHCEKTCQVSGLLYRDQDSWVDGDHCRNCTCKSGAVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSECK |
| Gene Sequence | CHCEKTCQVSGLLYRDQDSWVDGDHCRNCTCKSGAVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSECK |
| Gene ID - Mouse | ENSMUSG00000055409 |
| Gene ID - Rat | ENSRNOG00000015675 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NELL1 pAb (ATL-HPA051535) | |
| Datasheet | Anti NELL1 pAb (ATL-HPA051535) Datasheet (External Link) |
| Vendor Page | Anti NELL1 pAb (ATL-HPA051535) at Atlas Antibodies |
| Documents & Links for Anti NELL1 pAb (ATL-HPA051535) | |
| Datasheet | Anti NELL1 pAb (ATL-HPA051535) Datasheet (External Link) |
| Vendor Page | Anti NELL1 pAb (ATL-HPA051535) |
| Citations for Anti NELL1 pAb (ATL-HPA051535) – 2 Found |
| Kudose, Satoru; Sekulic, Miroslav; Mehring, Collette J; Santoriello, Dominick; Batal, Ibrahim; Stokes, M Barry; D'Agati, Vivette D; Markowitz, Glen S. NELL1-Associated Membranous Glomerulopathy After Hematopoietic Stem Cell Transplantation. Kidney International Reports. 2021;6(7):1992-1995. PubMed |
| Nakamura, Ritsuko; Oyama, Takeru; Tajiri, Ryosuke; Mizokami, Atsushi; Namiki, Mikio; Nakamoto, Masaru; Ooi, Akishi. Expression and regulatory effects on cancer cell behavior of NELL1 and NELL2 in human renal cell carcinoma. Cancer Science. 2015;106(5):656-64. PubMed |