Anti NELFCD pAb (ATL-HPA074936)

Atlas Antibodies

Catalog No.: ATL-HPA074936-25

Protein Description: negative elongation factor complex member C/D
Gene Name: NELFCD
Alternative Gene Name: HSPC130, NELF-C, NELF-D, TH1, TH1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016253: 98%, ENSRNOG00000047874: 64%
Entrez Gene ID: 51497
Uniprot ID: Q8IXH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCH
• Gene Sequence: KRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCH
• Gene ID - Mouse: ENSMUSG00000016253
• Gene ID - Rat: ENSRNOG00000047874
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.