Anti NELFCD pAb (ATL-HPA074936)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074936-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NELFCD
Alternative Gene Name: HSPC130, NELF-C, NELF-D, TH1, TH1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016253: 98%, ENSRNOG00000047874: 64%
Entrez Gene ID: 51497
Uniprot ID: Q8IXH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCH |
Gene Sequence | KRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCH |
Gene ID - Mouse | ENSMUSG00000016253 |
Gene ID - Rat | ENSRNOG00000047874 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NELFCD pAb (ATL-HPA074936) | |
Datasheet | Anti NELFCD pAb (ATL-HPA074936) Datasheet (External Link) |
Vendor Page | Anti NELFCD pAb (ATL-HPA074936) at Atlas Antibodies |
Documents & Links for Anti NELFCD pAb (ATL-HPA074936) | |
Datasheet | Anti NELFCD pAb (ATL-HPA074936) Datasheet (External Link) |
Vendor Page | Anti NELFCD pAb (ATL-HPA074936) |