Anti NELFCD pAb (ATL-HPA066262)

Atlas Antibodies

Catalog No.:
ATL-HPA066262-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: negative elongation factor complex member C/D
Gene Name: NELFCD
Alternative Gene Name: HSPC130, NELF-C, NELF-D, TH1, TH1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016253: 98%, ENSRNOG00000047874: 64%
Entrez Gene ID: 51497
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCH
Gene Sequence KRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCH
Gene ID - Mouse ENSMUSG00000016253
Gene ID - Rat ENSRNOG00000047874
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NELFCD pAb (ATL-HPA066262)
Datasheet Anti NELFCD pAb (ATL-HPA066262) Datasheet (External Link)
Vendor Page Anti NELFCD pAb (ATL-HPA066262) at Atlas Antibodies

Documents & Links for Anti NELFCD pAb (ATL-HPA066262)
Datasheet Anti NELFCD pAb (ATL-HPA066262) Datasheet (External Link)
Vendor Page Anti NELFCD pAb (ATL-HPA066262)