Anti NELFA pAb (ATL-HPA043931)

Atlas Antibodies

Catalog No.: ATL-HPA043931-25

Protein Description: negative elongation factor complex member A
Gene Name: NELFA
Alternative Gene Name: NELF-A, WHSC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029111: 98%, ENSRNOG00000015474: 98%
Entrez Gene ID: 7469
Uniprot ID: Q9H3P2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTGSLNLELEEQNPNVQDILGELREKVGECEASAMLPLECQYLNKNALTTLAGPLTPPVKHFQLKRKPKSATLRAELLQKSTET
• Gene Sequence: DTGSLNLELEEQNPNVQDILGELREKVGECEASAMLPLECQYLNKNALTTLAGPLTPPVKHFQLKRKPKSATLRAELLQKSTET
• Gene ID - Mouse: ENSMUSG00000029111
• Gene ID - Rat: ENSRNOG00000015474
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.