Anti NEK4 pAb (ATL-HPA058543)

Atlas Antibodies

Catalog No.:
ATL-HPA058543-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: NIMA related kinase 4
Gene Name: NEK4
Alternative Gene Name: NRK2, pp12301, STK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021918: 72%, ENSRNOG00000017997: 69%
Entrez Gene ID: 6787
Uniprot ID: P51957
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YGEGKGQTNEINALVQLMTQTLKLDSKESCEDVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRG
Gene Sequence YGEGKGQTNEINALVQLMTQTLKLDSKESCEDVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRG
Gene ID - Mouse ENSMUSG00000021918
Gene ID - Rat ENSRNOG00000017997
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NEK4 pAb (ATL-HPA058543)
Datasheet Anti NEK4 pAb (ATL-HPA058543) Datasheet (External Link)
Vendor Page Anti NEK4 pAb (ATL-HPA058543) at Atlas Antibodies

Documents & Links for Anti NEK4 pAb (ATL-HPA058543)
Datasheet Anti NEK4 pAb (ATL-HPA058543) Datasheet (External Link)
Vendor Page Anti NEK4 pAb (ATL-HPA058543)