Anti NEK2 pAb (ATL-HPA064967)

Atlas Antibodies

Catalog No.:
ATL-HPA064967-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: NIMA-related kinase 2
Gene Name: NEK2
Alternative Gene Name: NEK2A, NLK1, PPP1R111, RP67
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110797: 87%, ENSRNOG00000004487: 87%
Entrez Gene ID: 4751
Uniprot ID: P51955
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPE
Gene Sequence FSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPE
Gene ID - Mouse ENSMUSG00000110797
Gene ID - Rat ENSRNOG00000004487
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NEK2 pAb (ATL-HPA064967)
Datasheet Anti NEK2 pAb (ATL-HPA064967) Datasheet (External Link)
Vendor Page Anti NEK2 pAb (ATL-HPA064967) at Atlas Antibodies

Documents & Links for Anti NEK2 pAb (ATL-HPA064967)
Datasheet Anti NEK2 pAb (ATL-HPA064967) Datasheet (External Link)
Vendor Page Anti NEK2 pAb (ATL-HPA064967)