Anti NEK2 pAb (ATL-HPA064967)

Atlas Antibodies

Catalog No.: ATL-HPA064967-25

Protein Description: NIMA-related kinase 2
Gene Name: NEK2
Alternative Gene Name: NEK2A, NLK1, PPP1R111, RP67
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110797: 87%, ENSRNOG00000004487: 87%
Entrez Gene ID: 4751
Uniprot ID: P51955
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPE
• Gene Sequence: FSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPE
• Gene ID - Mouse: ENSMUSG00000110797
• Gene ID - Rat: ENSRNOG00000004487
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.