Anti NEIL2 pAb (ATL-HPA073916)

Atlas Antibodies

SKU: ATL-HPA073916-25

• 

Protein Description: nei like DNA glycosylase 2
Gene Name: NEIL2
Alternative Gene Name: FLJ31644, MGC2832, MGC4505, NEH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035121: 74%, ENSRNOG00000010696: 76%
Entrez Gene ID: 252969
Uniprot ID: Q969S2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS
• Gene Sequence: IHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS
• Gene ID - Mouse: ENSMUSG00000035121
• Gene ID - Rat: ENSRNOG00000010696
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.