Anti NEDD9 pAb (ATL-HPA009689)
Atlas Antibodies
- Catalog No.:
- ATL-HPA009689-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: NEDD9
Alternative Gene Name: CAS-L, CASS2, HEF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021365: 89%, ENSRNOG00000014548: 90%
Entrez Gene ID: 4739
Uniprot ID: Q14511
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPMQETASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPS |
| Gene Sequence | ILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPMQETASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPS |
| Gene ID - Mouse | ENSMUSG00000021365 |
| Gene ID - Rat | ENSRNOG00000014548 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NEDD9 pAb (ATL-HPA009689) | |
| Datasheet | Anti NEDD9 pAb (ATL-HPA009689) Datasheet (External Link) |
| Vendor Page | Anti NEDD9 pAb (ATL-HPA009689) at Atlas Antibodies |
| Documents & Links for Anti NEDD9 pAb (ATL-HPA009689) | |
| Datasheet | Anti NEDD9 pAb (ATL-HPA009689) Datasheet (External Link) |
| Vendor Page | Anti NEDD9 pAb (ATL-HPA009689) |