Anti NEDD9 pAb (ATL-HPA009689)

Atlas Antibodies

Catalog No.:
ATL-HPA009689-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: neural precursor cell expressed, developmentally down-regulated 9
Gene Name: NEDD9
Alternative Gene Name: CAS-L, CASS2, HEF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021365: 89%, ENSRNOG00000014548: 90%
Entrez Gene ID: 4739
Uniprot ID: Q14511
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPMQETASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPS
Gene Sequence ILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPMQETASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPS
Gene ID - Mouse ENSMUSG00000021365
Gene ID - Rat ENSRNOG00000014548
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NEDD9 pAb (ATL-HPA009689)
Datasheet Anti NEDD9 pAb (ATL-HPA009689) Datasheet (External Link)
Vendor Page Anti NEDD9 pAb (ATL-HPA009689) at Atlas Antibodies

Documents & Links for Anti NEDD9 pAb (ATL-HPA009689)
Datasheet Anti NEDD9 pAb (ATL-HPA009689) Datasheet (External Link)
Vendor Page Anti NEDD9 pAb (ATL-HPA009689)