Anti NEDD4L pAb (ATL-HPA064730)

Atlas Antibodies

Catalog No.: ATL-HPA064730-25

Protein Description: neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
Gene Name: NEDD4L
Alternative Gene Name: KIAA0439, NEDD4-2, RSP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024589: 97%, ENSRNOG00000017610: 97%
Entrez Gene ID: 23327
Uniprot ID: Q96PU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEENSDQRDDMEHGWEVVDSNDSASQHQEELPPPP
• Gene Sequence: DEENSDQRDDMEHGWEVVDSNDSASQHQEELPPPP
• Gene ID - Mouse: ENSMUSG00000024589
• Gene ID - Rat: ENSRNOG00000017610
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.