Anti NEDD4L pAb (ATL-HPA064730)

Atlas Antibodies

Catalog No.:
ATL-HPA064730-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
Gene Name: NEDD4L
Alternative Gene Name: KIAA0439, NEDD4-2, RSP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024589: 97%, ENSRNOG00000017610: 97%
Entrez Gene ID: 23327
Uniprot ID: Q96PU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEENSDQRDDMEHGWEVVDSNDSASQHQEELPPPP
Gene Sequence DEENSDQRDDMEHGWEVVDSNDSASQHQEELPPPP
Gene ID - Mouse ENSMUSG00000024589
Gene ID - Rat ENSRNOG00000017610
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NEDD4L pAb (ATL-HPA064730)
Datasheet Anti NEDD4L pAb (ATL-HPA064730) Datasheet (External Link)
Vendor Page Anti NEDD4L pAb (ATL-HPA064730) at Atlas Antibodies

Documents & Links for Anti NEDD4L pAb (ATL-HPA064730)
Datasheet Anti NEDD4L pAb (ATL-HPA064730) Datasheet (External Link)
Vendor Page Anti NEDD4L pAb (ATL-HPA064730)