Anti NECAB3 pAb (ATL-HPA044785)

Atlas Antibodies

Catalog No.:
ATL-HPA044785-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: N-terminal EF-hand calcium binding protein 3
Gene Name: NECAB3
Alternative Gene Name: APBA2BP, dJ63M2.4, dJ63M2.5, EFCBP3, NIP1, SYTIP2, XB51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027489: 91%, ENSRNOG00000016708: 92%
Entrez Gene ID: 63941
Uniprot ID: Q96P71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNN
Gene Sequence QDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNN
Gene ID - Mouse ENSMUSG00000027489
Gene ID - Rat ENSRNOG00000016708
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NECAB3 pAb (ATL-HPA044785)
Datasheet Anti NECAB3 pAb (ATL-HPA044785) Datasheet (External Link)
Vendor Page Anti NECAB3 pAb (ATL-HPA044785) at Atlas Antibodies

Documents & Links for Anti NECAB3 pAb (ATL-HPA044785)
Datasheet Anti NECAB3 pAb (ATL-HPA044785) Datasheet (External Link)
Vendor Page Anti NECAB3 pAb (ATL-HPA044785)