Anti NECAB2 pAb (ATL-HPA013998 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA013998-25

Protein Description: N-terminal EF-hand calcium binding protein 2
Gene Name: NECAB2
Alternative Gene Name: EFCBP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031837: 98%, ENSRNOG00000015084: 97%
Entrez Gene ID: 54550
Uniprot ID: Q7Z6G3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELCDYFVDHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQL
• Gene Sequence: VILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELCDYFVDHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQL
• Gene ID - Mouse: ENSMUSG00000031837
• Gene ID - Rat: ENSRNOG00000015084
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NECAB2 pAb (ATL-HPA013998 w/enhanced validation) – 6 Found

Alshawaf, Abdullah Jawad; Viventi, Serena; Qiu, Wanzhi; D'Abaco, Giovanna; Nayagam, Bryony; Erlichster, Michael; Chana, Gursharan; Everall, Ian; Ivanusic, Jason; Skafidas, Efstratios; Dottori, Mirella. Phenotypic and Functional Characterization of Peripheral Sensory Neurons derived from Human Embryonic Stem Cells. Scientific Reports. 2018;8(1):603. 

Viventi, Serena; Frausin, Stefano; Howden, Sara E; Lim, Shiang Y; Finol-Urdaneta, Rocio K; McArthur, Jeffrey R; Abu-Bonsrah, Kwaku Dad; Ng, Wayne; Ivanusic, Jason; Thompson, Lachlan; Dottori, Mirella. In vivo survival and differentiation of Friedreich ataxia iPSC-derived sensory neurons transplanted in the adult dorsal root ganglia. Stem Cells Translational Medicine. 2021;10(8):1157-1169. 

Zhang, Ming-Dong; Tortoriello, Giuseppe; Hsueh, Brian; Tomer, Raju; Ye, Li; Mitsios, Nicholas; Borgius, Lotta; Grant, Gunnar; Kiehn, Ole; Watanabe, Masahiko; Uhlén, Mathias; Mulder, Jan; Deisseroth, Karl; Harkany, Tibor; Hökfelt, Tomas G M. Neuronal calcium-binding proteins 1/2 localize to dorsal root ganglia and excitatory spinal neurons and are regulated by nerve injury. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2014;111(12):E1149-58. 

Zhang, Ming-Dong; Su, Jie; Adori, Csaba; Cinquina, Valentina; Malenczyk, Katarzyna; Girach, Fatima; Peng, Changgeng; Ernfors, Patrik; Löw, Peter; Borgius, Lotta; Kiehn, Ole; Watanabe, Masahiko; Uhlén, Mathias; Mitsios, Nicholas; Mulder, Jan; Harkany, Tibor; Hökfelt, Tomas. Ca2+-binding protein NECAB2 facilitates inflammatory pain hypersensitivity. The Journal Of Clinical Investigation. 2018;128(9):3757-3768. 

Miczán, Vivien; Kelemen, Krisztina; Glavinics, Judit R; László, Zsófia I; Barti, Benjámin; Kenesei, Kata; Kisfali, Máté; Katona, István. NECAB1 and NECAB2 are Prevalent Calcium-Binding Proteins of CB1/CCK-Positive GABAergic Interneurons. Cerebral Cortex (New York, N.y. : 1991). 2021;31(3):1786-1806. 

Sanders, Marie; Petrasch-Parwez, Elisabeth; Habbes, Hans-Werner; Düring, Monika V; Förster, Eckart. Postnatal Developmental Expression Profile Classifies the Indusium Griseum as a Distinct Subfield of the Hippocampal Formation. Frontiers In Cell And Developmental Biology. 8( 33511122):615571.