Anti NDUFV2 pAb (ATL-HPA077896)

Atlas Antibodies

Catalog No.:
ATL-HPA077896-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa
Gene Name: NDUFV2
Alternative Gene Name: CI-24k
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024099: 87%, ENSRNOG00000042503: 87%
Entrez Gene ID: 4729
Uniprot ID: P19404
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNY
Gene Sequence MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNY
Gene ID - Mouse ENSMUSG00000024099
Gene ID - Rat ENSRNOG00000042503
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDUFV2 pAb (ATL-HPA077896)
Datasheet Anti NDUFV2 pAb (ATL-HPA077896) Datasheet (External Link)
Vendor Page Anti NDUFV2 pAb (ATL-HPA077896) at Atlas Antibodies

Documents & Links for Anti NDUFV2 pAb (ATL-HPA077896)
Datasheet Anti NDUFV2 pAb (ATL-HPA077896) Datasheet (External Link)
Vendor Page Anti NDUFV2 pAb (ATL-HPA077896)