Anti NDUFV2 pAb (ATL-HPA077896)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077896-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NDUFV2
Alternative Gene Name: CI-24k
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024099: 87%, ENSRNOG00000042503: 87%
Entrez Gene ID: 4729
Uniprot ID: P19404
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNY |
| Gene Sequence | MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNY |
| Gene ID - Mouse | ENSMUSG00000024099 |
| Gene ID - Rat | ENSRNOG00000042503 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NDUFV2 pAb (ATL-HPA077896) | |
| Datasheet | Anti NDUFV2 pAb (ATL-HPA077896) Datasheet (External Link) |
| Vendor Page | Anti NDUFV2 pAb (ATL-HPA077896) at Atlas Antibodies |
| Documents & Links for Anti NDUFV2 pAb (ATL-HPA077896) | |
| Datasheet | Anti NDUFV2 pAb (ATL-HPA077896) Datasheet (External Link) |
| Vendor Page | Anti NDUFV2 pAb (ATL-HPA077896) |