Anti NDUFV2 pAb (ATL-HPA003404)

Atlas Antibodies

Catalog No.: ATL-HPA003404-25

Protein Description: NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa
Gene Name: NDUFV2
Alternative Gene Name: CI-24k
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024099: 95%, ENSRNOG00000042503: 95%
Entrez Gene ID: 4729
Uniprot ID: P19404
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEE
• Gene Sequence: PEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEE
• Gene ID - Mouse: ENSMUSG00000024099
• Gene ID - Rat: ENSRNOG00000042503
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NDUFV2 pAb (ATL-HPA003404) – 3 Found

Choi, Joungil; Batchu, Vera Venkatanaresh Kumar; Schubert, Manfred; Castellani, Rudolph J; Russell, James W. A novel PGC-1α isoform in brain localizes to mitochondria and associates with PINK1 and VDAC. Biochemical And Biophysical Research Communications. 2013;435(4):671-7. 

Desmurs, Marjorie; Foti, Michelangelo; Raemy, Etienne; Vaz, Frédéric Maxime; Martinou, Jean-Claude; Bairoch, Amos; Lane, Lydie. C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization. Molecular And Cellular Biology. 2015;35(7):1139-56. 

Wu, Xiu-Ming; Yang, Chang-Qing; Mao, Ying-Bo; Wang, Ling-Jian; Shangguan, Xiao-Xia; Chen, Xiao-Ya. Targeting insect mitochondrial complex I for plant protection. Plant Biotechnology Journal. 2016;14(9):1925-35.