Anti NDUFS1 pAb (ATL-HPA064605)
Atlas Antibodies
- SKU:
- ATL-HPA064605-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NDUFS1
Alternative Gene Name: CI-75k
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025968: 93%, ENSRNOG00000011849: 91%
Entrez Gene ID: 4719
Uniprot ID: P28331
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | REDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAV |
Gene Sequence | REDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAV |
Gene ID - Mouse | ENSMUSG00000025968 |
Gene ID - Rat | ENSRNOG00000011849 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NDUFS1 pAb (ATL-HPA064605) | |
Datasheet | Anti NDUFS1 pAb (ATL-HPA064605) Datasheet (External Link) |
Vendor Page | Anti NDUFS1 pAb (ATL-HPA064605) at Atlas Antibodies |
Documents & Links for Anti NDUFS1 pAb (ATL-HPA064605) | |
Datasheet | Anti NDUFS1 pAb (ATL-HPA064605) Datasheet (External Link) |
Vendor Page | Anti NDUFS1 pAb (ATL-HPA064605) |