Anti NDUFS1 pAb (ATL-HPA064605)

Atlas Antibodies

SKU:
ATL-HPA064605-25
  • Immunofluorescent staining of human cell line RH-30 shows localization to mitochondria.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Q reductase)
Gene Name: NDUFS1
Alternative Gene Name: CI-75k
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025968: 93%, ENSRNOG00000011849: 91%
Entrez Gene ID: 4719
Uniprot ID: P28331
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAV
Gene Sequence REDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAV
Gene ID - Mouse ENSMUSG00000025968
Gene ID - Rat ENSRNOG00000011849
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NDUFS1 pAb (ATL-HPA064605)
Datasheet Anti NDUFS1 pAb (ATL-HPA064605) Datasheet (External Link)
Vendor Page Anti NDUFS1 pAb (ATL-HPA064605) at Atlas Antibodies

Documents & Links for Anti NDUFS1 pAb (ATL-HPA064605)
Datasheet Anti NDUFS1 pAb (ATL-HPA064605) Datasheet (External Link)
Vendor Page Anti NDUFS1 pAb (ATL-HPA064605)