Anti NDUFS1 pAb (ATL-HPA064605)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064605-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NDUFS1
Alternative Gene Name: CI-75k
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025968: 93%, ENSRNOG00000011849: 91%
Entrez Gene ID: 4719
Uniprot ID: P28331
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | REDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAV |
| Gene Sequence | REDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAV |
| Gene ID - Mouse | ENSMUSG00000025968 |
| Gene ID - Rat | ENSRNOG00000011849 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NDUFS1 pAb (ATL-HPA064605) | |
| Datasheet | Anti NDUFS1 pAb (ATL-HPA064605) Datasheet (External Link) |
| Vendor Page | Anti NDUFS1 pAb (ATL-HPA064605) at Atlas Antibodies |
| Documents & Links for Anti NDUFS1 pAb (ATL-HPA064605) | |
| Datasheet | Anti NDUFS1 pAb (ATL-HPA064605) Datasheet (External Link) |
| Vendor Page | Anti NDUFS1 pAb (ATL-HPA064605) |