Anti NDUFC2 pAb (ATL-HPA056195)

Atlas Antibodies

Catalog No.: ATL-HPA056195-25

Protein Description: NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa
Gene Name: NDUFC2
Alternative Gene Name: B14.5b, HLC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030647: 69%, ENSRNOG00000012383: 71%
Entrez Gene ID: 4718
Uniprot ID: O95298
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDK
• Gene Sequence: GYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDK
• Gene ID - Mouse: ENSMUSG00000030647
• Gene ID - Rat: ENSRNOG00000012383
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.