Anti NDUFC2 pAb (ATL-HPA056195)

Atlas Antibodies

Catalog No.:
ATL-HPA056195-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa
Gene Name: NDUFC2
Alternative Gene Name: B14.5b, HLC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030647: 69%, ENSRNOG00000012383: 71%
Entrez Gene ID: 4718
Uniprot ID: O95298
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDK
Gene Sequence GYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDK
Gene ID - Mouse ENSMUSG00000030647
Gene ID - Rat ENSRNOG00000012383
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDUFC2 pAb (ATL-HPA056195)
Datasheet Anti NDUFC2 pAb (ATL-HPA056195) Datasheet (External Link)
Vendor Page Anti NDUFC2 pAb (ATL-HPA056195) at Atlas Antibodies

Documents & Links for Anti NDUFC2 pAb (ATL-HPA056195)
Datasheet Anti NDUFC2 pAb (ATL-HPA056195) Datasheet (External Link)
Vendor Page Anti NDUFC2 pAb (ATL-HPA056195)