Anti NDUFB4 pAb (ATL-HPA064441)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064441-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NDUFB4
Alternative Gene Name: B15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022820: 74%, ENSRNOG00000034182: 74%
Entrez Gene ID: 4710
Uniprot ID: O95168
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LKREYLLQYNDPNRRGLIENPALLRWAYART |
| Gene Sequence | LKREYLLQYNDPNRRGLIENPALLRWAYART |
| Gene ID - Mouse | ENSMUSG00000022820 |
| Gene ID - Rat | ENSRNOG00000034182 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NDUFB4 pAb (ATL-HPA064441) | |
| Datasheet | Anti NDUFB4 pAb (ATL-HPA064441) Datasheet (External Link) |
| Vendor Page | Anti NDUFB4 pAb (ATL-HPA064441) at Atlas Antibodies |
| Documents & Links for Anti NDUFB4 pAb (ATL-HPA064441) | |
| Datasheet | Anti NDUFB4 pAb (ATL-HPA064441) Datasheet (External Link) |
| Vendor Page | Anti NDUFB4 pAb (ATL-HPA064441) |