Anti NDUFB4 pAb (ATL-HPA064441)

Atlas Antibodies

Catalog No.:
ATL-HPA064441-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: NADH:ubiquinone oxidoreductase subunit B4
Gene Name: NDUFB4
Alternative Gene Name: B15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022820: 74%, ENSRNOG00000034182: 74%
Entrez Gene ID: 4710
Uniprot ID: O95168
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKREYLLQYNDPNRRGLIENPALLRWAYART
Gene Sequence LKREYLLQYNDPNRRGLIENPALLRWAYART
Gene ID - Mouse ENSMUSG00000022820
Gene ID - Rat ENSRNOG00000034182
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDUFB4 pAb (ATL-HPA064441)
Datasheet Anti NDUFB4 pAb (ATL-HPA064441) Datasheet (External Link)
Vendor Page Anti NDUFB4 pAb (ATL-HPA064441) at Atlas Antibodies

Documents & Links for Anti NDUFB4 pAb (ATL-HPA064441)
Datasheet Anti NDUFB4 pAb (ATL-HPA064441) Datasheet (External Link)
Vendor Page Anti NDUFB4 pAb (ATL-HPA064441)