Anti NDUFB2 pAb (ATL-HPA051377)

Atlas Antibodies

Catalog No.:
ATL-HPA051377-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2, 8kDa
Gene Name: NDUFB2
Alternative Gene Name: AGGG, CI-AGGG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002416: 87%, ENSRNOG00000026616: 79%
Entrez Gene ID: 4708
Uniprot ID: O95178
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED
Gene Sequence QVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED
Gene ID - Mouse ENSMUSG00000002416
Gene ID - Rat ENSRNOG00000026616
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDUFB2 pAb (ATL-HPA051377)
Datasheet Anti NDUFB2 pAb (ATL-HPA051377) Datasheet (External Link)
Vendor Page Anti NDUFB2 pAb (ATL-HPA051377) at Atlas Antibodies

Documents & Links for Anti NDUFB2 pAb (ATL-HPA051377)
Datasheet Anti NDUFB2 pAb (ATL-HPA051377) Datasheet (External Link)
Vendor Page Anti NDUFB2 pAb (ATL-HPA051377)