Anti NDUFB2 pAb (ATL-HPA051377)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051377-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NDUFB2
Alternative Gene Name: AGGG, CI-AGGG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002416: 87%, ENSRNOG00000026616: 79%
Entrez Gene ID: 4708
Uniprot ID: O95178
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED |
| Gene Sequence | QVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED |
| Gene ID - Mouse | ENSMUSG00000002416 |
| Gene ID - Rat | ENSRNOG00000026616 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NDUFB2 pAb (ATL-HPA051377) | |
| Datasheet | Anti NDUFB2 pAb (ATL-HPA051377) Datasheet (External Link) |
| Vendor Page | Anti NDUFB2 pAb (ATL-HPA051377) at Atlas Antibodies |
| Documents & Links for Anti NDUFB2 pAb (ATL-HPA051377) | |
| Datasheet | Anti NDUFB2 pAb (ATL-HPA051377) Datasheet (External Link) |
| Vendor Page | Anti NDUFB2 pAb (ATL-HPA051377) |