Anti NDUFB1 pAb (ATL-HPA063737)

Atlas Antibodies

Catalog No.: ATL-HPA063737-25

Protein Description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa
Gene Name: NDUFB1
Alternative Gene Name: CI-MNLL, MNLL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050668: 36%, ENSRNOG00000025317: 39%
Entrez Gene ID: 4707
Uniprot ID: O75438
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
• Gene Sequence: LDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
• Gene ID - Mouse: ENSMUSG00000050668
• Gene ID - Rat: ENSRNOG00000025317
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.