Anti NDUFB1 pAb (ATL-HPA063737)
Atlas Antibodies
- SKU:
- ATL-HPA063737-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NDUFB1
Alternative Gene Name: CI-MNLL, MNLL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050668: 36%, ENSRNOG00000025317: 39%
Entrez Gene ID: 4707
Uniprot ID: O75438
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LDRKSDERLTAFRNKSMLFKRELQPSEEVTWK |
Gene Sequence | LDRKSDERLTAFRNKSMLFKRELQPSEEVTWK |
Gene ID - Mouse | ENSMUSG00000050668 |
Gene ID - Rat | ENSRNOG00000025317 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NDUFB1 pAb (ATL-HPA063737) | |
Datasheet | Anti NDUFB1 pAb (ATL-HPA063737) Datasheet (External Link) |
Vendor Page | Anti NDUFB1 pAb (ATL-HPA063737) at Atlas Antibodies |
Documents & Links for Anti NDUFB1 pAb (ATL-HPA063737) | |
Datasheet | Anti NDUFB1 pAb (ATL-HPA063737) Datasheet (External Link) |
Vendor Page | Anti NDUFB1 pAb (ATL-HPA063737) |