Anti NDUFB1 pAb (ATL-HPA063737)

Atlas Antibodies

Catalog No.:
ATL-HPA063737-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa
Gene Name: NDUFB1
Alternative Gene Name: CI-MNLL, MNLL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050668: 36%, ENSRNOG00000025317: 39%
Entrez Gene ID: 4707
Uniprot ID: O75438
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
Gene Sequence LDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
Gene ID - Mouse ENSMUSG00000050668
Gene ID - Rat ENSRNOG00000025317
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDUFB1 pAb (ATL-HPA063737)
Datasheet Anti NDUFB1 pAb (ATL-HPA063737) Datasheet (External Link)
Vendor Page Anti NDUFB1 pAb (ATL-HPA063737) at Atlas Antibodies

Documents & Links for Anti NDUFB1 pAb (ATL-HPA063737)
Datasheet Anti NDUFB1 pAb (ATL-HPA063737) Datasheet (External Link)
Vendor Page Anti NDUFB1 pAb (ATL-HPA063737)