Anti NDUFAF6 pAb (ATL-HPA050545)

Atlas Antibodies

Catalog No.:
ATL-HPA050545-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) complex I, assembly factor 6
Gene Name: NDUFAF6
Alternative Gene Name: C8orf38, MGC40214
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050323: 89%, ENSRNOG00000040040: 91%
Entrez Gene ID: 137682
Uniprot ID: Q330K2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NVRDVIYDIASQAHLHLKHARSFHKTVPVKAFPAFLQTVSLEDFLKKIQRVDFDIFHPSLQQKNTLLPLYLYIQS
Gene Sequence NVRDVIYDIASQAHLHLKHARSFHKTVPVKAFPAFLQTVSLEDFLKKIQRVDFDIFHPSLQQKNTLLPLYLYIQS
Gene ID - Mouse ENSMUSG00000050323
Gene ID - Rat ENSRNOG00000040040
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDUFAF6 pAb (ATL-HPA050545)
Datasheet Anti NDUFAF6 pAb (ATL-HPA050545) Datasheet (External Link)
Vendor Page Anti NDUFAF6 pAb (ATL-HPA050545) at Atlas Antibodies

Documents & Links for Anti NDUFAF6 pAb (ATL-HPA050545)
Datasheet Anti NDUFAF6 pAb (ATL-HPA050545) Datasheet (External Link)
Vendor Page Anti NDUFAF6 pAb (ATL-HPA050545)