Anti NDUFAF6 pAb (ATL-HPA050545)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050545-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NDUFAF6
Alternative Gene Name: C8orf38, MGC40214
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050323: 89%, ENSRNOG00000040040: 91%
Entrez Gene ID: 137682
Uniprot ID: Q330K2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NVRDVIYDIASQAHLHLKHARSFHKTVPVKAFPAFLQTVSLEDFLKKIQRVDFDIFHPSLQQKNTLLPLYLYIQS |
| Gene Sequence | NVRDVIYDIASQAHLHLKHARSFHKTVPVKAFPAFLQTVSLEDFLKKIQRVDFDIFHPSLQQKNTLLPLYLYIQS |
| Gene ID - Mouse | ENSMUSG00000050323 |
| Gene ID - Rat | ENSRNOG00000040040 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NDUFAF6 pAb (ATL-HPA050545) | |
| Datasheet | Anti NDUFAF6 pAb (ATL-HPA050545) Datasheet (External Link) |
| Vendor Page | Anti NDUFAF6 pAb (ATL-HPA050545) at Atlas Antibodies |
| Documents & Links for Anti NDUFAF6 pAb (ATL-HPA050545) | |
| Datasheet | Anti NDUFAF6 pAb (ATL-HPA050545) Datasheet (External Link) |
| Vendor Page | Anti NDUFAF6 pAb (ATL-HPA050545) |