Anti NDUFAB1 pAb (ATL-HPA054364)

Atlas Antibodies

Catalog No.:
ATL-HPA054364-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa
Gene Name: NDUFAB1
Alternative Gene Name: ACP, FASN2A, SDAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030869: 73%, ENSRNOG00000018129: 76%
Entrez Gene ID: 4706
Uniprot ID: O14561
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGI
Gene Sequence MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGI
Gene ID - Mouse ENSMUSG00000030869
Gene ID - Rat ENSRNOG00000018129
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDUFAB1 pAb (ATL-HPA054364)
Datasheet Anti NDUFAB1 pAb (ATL-HPA054364) Datasheet (External Link)
Vendor Page Anti NDUFAB1 pAb (ATL-HPA054364) at Atlas Antibodies

Documents & Links for Anti NDUFAB1 pAb (ATL-HPA054364)
Datasheet Anti NDUFAB1 pAb (ATL-HPA054364) Datasheet (External Link)
Vendor Page Anti NDUFAB1 pAb (ATL-HPA054364)