Anti NDUFA9 pAb (ATL-HPA073212)

Atlas Antibodies

SKU: ATL-HPA073212-100

• 
• 

Protein Description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
Gene Name: NDUFA9
Alternative Gene Name: CI-39k, NDUFS2L, SDR22E1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000399: 74%, ENSRNOG00000061684: 70%
Entrez Gene ID: 4704
Uniprot ID: Q16795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPL
• Gene Sequence: AQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPL
• Gene ID - Mouse: ENSMUSG00000000399
• Gene ID - Rat: ENSRNOG00000061684
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.