Anti NDUFA7 pAb (ATL-HPA071866 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA071866-25

• 
• 

Protein Description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa
Gene Name: NDUFA7
Alternative Gene Name: B14.5a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041881: 90%, ENSRNOG00000006939: 88%
Entrez Gene ID: 4701
Uniprot ID: O95182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL
• Gene Sequence: SVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL
• Gene ID - Mouse: ENSMUSG00000041881
• Gene ID - Rat: ENSRNOG00000006939
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.