Anti NDUFA10 pAb (ATL-HPA067045)

Atlas Antibodies

Catalog No.:
ATL-HPA067045-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: NADH:ubiquinone oxidoreductase subunit A10
Gene Name: NDUFA10
Alternative Gene Name: CI-42k
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026260: 73%, ENSRNOG00000062245: 74%
Entrez Gene ID: 4705
Uniprot ID: O95299
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLT
Gene Sequence SSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLT
Gene ID - Mouse ENSMUSG00000026260
Gene ID - Rat ENSRNOG00000062245
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDUFA10 pAb (ATL-HPA067045)
Datasheet Anti NDUFA10 pAb (ATL-HPA067045) Datasheet (External Link)
Vendor Page Anti NDUFA10 pAb (ATL-HPA067045) at Atlas Antibodies

Documents & Links for Anti NDUFA10 pAb (ATL-HPA067045)
Datasheet Anti NDUFA10 pAb (ATL-HPA067045) Datasheet (External Link)
Vendor Page Anti NDUFA10 pAb (ATL-HPA067045)