Anti NDST2 pAb (ATL-HPA051515)

Atlas Antibodies

Catalog No.:
ATL-HPA051515-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 2
Gene Name: NDST2
Alternative Gene Name: HSST2, NST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039308: 93%, ENSRNOG00000057755: 93%
Entrez Gene ID: 8509
Uniprot ID: P52849
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YYSTHLQRWLTYYPSGQLLIVDGQELRTNPAASMESIQKFLGITPFLNYTRTLRFDDDKGF
Gene Sequence YYSTHLQRWLTYYPSGQLLIVDGQELRTNPAASMESIQKFLGITPFLNYTRTLRFDDDKGF
Gene ID - Mouse ENSMUSG00000039308
Gene ID - Rat ENSRNOG00000057755
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDST2 pAb (ATL-HPA051515)
Datasheet Anti NDST2 pAb (ATL-HPA051515) Datasheet (External Link)
Vendor Page Anti NDST2 pAb (ATL-HPA051515) at Atlas Antibodies

Documents & Links for Anti NDST2 pAb (ATL-HPA051515)
Datasheet Anti NDST2 pAb (ATL-HPA051515) Datasheet (External Link)
Vendor Page Anti NDST2 pAb (ATL-HPA051515)