Anti NDST2 pAb (ATL-HPA051515)

Atlas Antibodies

Catalog No.: ATL-HPA051515-25

Protein Description: N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 2
Gene Name: NDST2
Alternative Gene Name: HSST2, NST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039308: 93%, ENSRNOG00000057755: 93%
Entrez Gene ID: 8509
Uniprot ID: P52849
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YYSTHLQRWLTYYPSGQLLIVDGQELRTNPAASMESIQKFLGITPFLNYTRTLRFDDDKGF
• Gene Sequence: YYSTHLQRWLTYYPSGQLLIVDGQELRTNPAASMESIQKFLGITPFLNYTRTLRFDDDKGF
• Gene ID - Mouse: ENSMUSG00000039308
• Gene ID - Rat: ENSRNOG00000057755
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.