Anti NDST1 pAb (ATL-HPA060532)

Atlas Antibodies

Catalog No.:
ATL-HPA060532-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1
Gene Name: NDST1
Alternative Gene Name: HSST, NST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054008: 100%, ENSRNOG00000019014: 100%
Entrez Gene ID: 3340
Uniprot ID: P52848
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YEPVLLAKTRSSESIPHLGADAGLHAALHATVVQ
Gene Sequence YEPVLLAKTRSSESIPHLGADAGLHAALHATVVQ
Gene ID - Mouse ENSMUSG00000054008
Gene ID - Rat ENSRNOG00000019014
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDST1 pAb (ATL-HPA060532)
Datasheet Anti NDST1 pAb (ATL-HPA060532) Datasheet (External Link)
Vendor Page Anti NDST1 pAb (ATL-HPA060532) at Atlas Antibodies

Documents & Links for Anti NDST1 pAb (ATL-HPA060532)
Datasheet Anti NDST1 pAb (ATL-HPA060532) Datasheet (External Link)
Vendor Page Anti NDST1 pAb (ATL-HPA060532)