Anti NDP pAb (ATL-HPA003095)

Atlas Antibodies

Catalog No.:
ATL-HPA003095-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Norrie disease (pseudoglioma)
Gene Name: NDP
Alternative Gene Name: EVR2, norrin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040138: 95%, ENSRNOG00000046042: 95%
Entrez Gene ID: 4693
Uniprot ID: Q00604
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS
Gene Sequence TDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS
Gene ID - Mouse ENSMUSG00000040138
Gene ID - Rat ENSRNOG00000046042
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDP pAb (ATL-HPA003095)
Datasheet Anti NDP pAb (ATL-HPA003095) Datasheet (External Link)
Vendor Page Anti NDP pAb (ATL-HPA003095) at Atlas Antibodies

Documents & Links for Anti NDP pAb (ATL-HPA003095)
Datasheet Anti NDP pAb (ATL-HPA003095) Datasheet (External Link)
Vendor Page Anti NDP pAb (ATL-HPA003095)