Anti NDOR1 pAb (ATL-HPA024504)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024504-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: NDOR1
Alternative Gene Name: bA350O14.9, NR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006471: 86%, ENSRNOG00000010616: 88%
Entrez Gene ID: 27158
Uniprot ID: Q9UHB4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QPCSMRHLVSHYLDIASVPRRSFFELLACLSLHELEREKLLEFSSAQGQEELFEYCNRPRRTILEVLCDFPHTAAAIPPDYLLD |
| Gene Sequence | QPCSMRHLVSHYLDIASVPRRSFFELLACLSLHELEREKLLEFSSAQGQEELFEYCNRPRRTILEVLCDFPHTAAAIPPDYLLD |
| Gene ID - Mouse | ENSMUSG00000006471 |
| Gene ID - Rat | ENSRNOG00000010616 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NDOR1 pAb (ATL-HPA024504) | |
| Datasheet | Anti NDOR1 pAb (ATL-HPA024504) Datasheet (External Link) |
| Vendor Page | Anti NDOR1 pAb (ATL-HPA024504) at Atlas Antibodies |
| Documents & Links for Anti NDOR1 pAb (ATL-HPA024504) | |
| Datasheet | Anti NDOR1 pAb (ATL-HPA024504) Datasheet (External Link) |
| Vendor Page | Anti NDOR1 pAb (ATL-HPA024504) |