Anti NDOR1 pAb (ATL-HPA024504)

Atlas Antibodies

Catalog No.:
ATL-HPA024504-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: NADPH dependent diflavin oxidoreductase 1
Gene Name: NDOR1
Alternative Gene Name: bA350O14.9, NR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006471: 86%, ENSRNOG00000010616: 88%
Entrez Gene ID: 27158
Uniprot ID: Q9UHB4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen QPCSMRHLVSHYLDIASVPRRSFFELLACLSLHELEREKLLEFSSAQGQEELFEYCNRPRRTILEVLCDFPHTAAAIPPDYLLD
Gene Sequence QPCSMRHLVSHYLDIASVPRRSFFELLACLSLHELEREKLLEFSSAQGQEELFEYCNRPRRTILEVLCDFPHTAAAIPPDYLLD
Gene ID - Mouse ENSMUSG00000006471
Gene ID - Rat ENSRNOG00000010616
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDOR1 pAb (ATL-HPA024504)
Datasheet Anti NDOR1 pAb (ATL-HPA024504) Datasheet (External Link)
Vendor Page Anti NDOR1 pAb (ATL-HPA024504) at Atlas Antibodies

Documents & Links for Anti NDOR1 pAb (ATL-HPA024504)
Datasheet Anti NDOR1 pAb (ATL-HPA024504) Datasheet (External Link)
Vendor Page Anti NDOR1 pAb (ATL-HPA024504)