Anti NDN pAb (ATL-HPA074457)

Atlas Antibodies

Catalog No.: ATL-HPA074457-25

Protein Description: necdin, melanoma antigen (MAGE) family member
Gene Name: NDN
Alternative Gene Name: HsT16328, PWCR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033585: 88%, ENSRNOG00000010146: 88%
Entrez Gene ID: 4692
Uniprot ID: Q99608
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQLVQKAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSILRRTSLI
• Gene Sequence: AQLVQKAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSILRRTSLI
• Gene ID - Mouse: ENSMUSG00000033585
• Gene ID - Rat: ENSRNOG00000010146
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.