Anti NDN pAb (ATL-HPA074457)

Atlas Antibodies

Catalog No.:
ATL-HPA074457-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: necdin, melanoma antigen (MAGE) family member
Gene Name: NDN
Alternative Gene Name: HsT16328, PWCR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033585: 88%, ENSRNOG00000010146: 88%
Entrez Gene ID: 4692
Uniprot ID: Q99608
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AQLVQKAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSILRRTSLI
Gene Sequence AQLVQKAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSILRRTSLI
Gene ID - Mouse ENSMUSG00000033585
Gene ID - Rat ENSRNOG00000010146
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDN pAb (ATL-HPA074457)
Datasheet Anti NDN pAb (ATL-HPA074457) Datasheet (External Link)
Vendor Page Anti NDN pAb (ATL-HPA074457) at Atlas Antibodies

Documents & Links for Anti NDN pAb (ATL-HPA074457)
Datasheet Anti NDN pAb (ATL-HPA074457) Datasheet (External Link)
Vendor Page Anti NDN pAb (ATL-HPA074457)