Anti NDFIP2 pAb (ATL-HPA009160)

Atlas Antibodies

Catalog No.: ATL-HPA009160-25

Protein Description: Nedd4 family interacting protein 2
Gene Name: NDFIP2
Alternative Gene Name: KIAA1165, N4wbp5a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053253: 68%, ENSRNOG00000024022: 74%
Entrez Gene ID: 54602
Uniprot ID: Q9NV92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAAGATGSEELPPGDRGCRNGGGRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDN
• Gene Sequence: AAAGATGSEELPPGDRGCRNGGGRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDN
• Gene ID - Mouse: ENSMUSG00000053253
• Gene ID - Rat: ENSRNOG00000024022
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NDFIP2 pAb (ATL-HPA009160) – 2 Found

McKnight, Kevin L; Xie, Ling; González-López, Olga; Rivera-Serrano, Efraín E; Chen, Xian; Lemon, Stanley M. Protein composition of the hepatitis A virus quasi-envelope. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(25):6587-6592. 

Mejlvang, Jakob; Olsvik, Hallvard; Svenning, Steingrim; Bruun, Jack-Ansgar; Abudu, Yakubu Princely; Larsen, Kenneth Bowitz; Brech, Andreas; Hansen, Tom E; Brenne, Hanne; Hansen, Terkel; Stenmark, Harald; Johansen, Terje. Starvation induces rapid degradation of selective autophagy receptors by endosomal microautophagy. The Journal Of Cell Biology. 2018;217(10):3640-3655.