Anti NDFIP1 pAb (ATL-HPA009682)
Atlas Antibodies
- Catalog No.:
- ATL-HPA009682-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: NDFIP1
Alternative Gene Name: MGC10924, N4WBP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024425: 92%, ENSRNOG00000013562: 90%
Entrez Gene ID: 80762
Uniprot ID: Q9BT67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKP |
| Gene Sequence | SRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKP |
| Gene ID - Mouse | ENSMUSG00000024425 |
| Gene ID - Rat | ENSRNOG00000013562 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NDFIP1 pAb (ATL-HPA009682) | |
| Datasheet | Anti NDFIP1 pAb (ATL-HPA009682) Datasheet (External Link) |
| Vendor Page | Anti NDFIP1 pAb (ATL-HPA009682) at Atlas Antibodies |
| Documents & Links for Anti NDFIP1 pAb (ATL-HPA009682) | |
| Datasheet | Anti NDFIP1 pAb (ATL-HPA009682) Datasheet (External Link) |
| Vendor Page | Anti NDFIP1 pAb (ATL-HPA009682) |
| Citations for Anti NDFIP1 pAb (ATL-HPA009682) – 7 Found |
| Mejlvang, Jakob; Olsvik, Hallvard; Svenning, Steingrim; Bruun, Jack-Ansgar; Abudu, Yakubu Princely; Larsen, Kenneth Bowitz; Brech, Andreas; Hansen, Tom E; Brenne, Hanne; Hansen, Terkel; Stenmark, Harald; Johansen, Terje. Starvation induces rapid degradation of selective autophagy receptors by endosomal microautophagy. The Journal Of Cell Biology. 2018;217(10):3640-3655. PubMed |
| Routila, J; Leivo, I; Minn, H; Westermarck, J; Ventelä, Sami. Evaluation of prognostic biomarkers in a population-validated Finnish HNSCC patient cohort. European Archives Of Oto-Rhino-Laryngology : Official Journal Of The European Federation Of Oto-Rhino-Laryngological Societies (Eufos) : Affiliated With The German Society For Oto-Rhino-Laryngology - Head And Neck Surgery. 2021;278(11):4575-4585. PubMed |
| Routila, Johannes; Suvila, Karri; Grénman, Reidar; Leivo, Ilmo; Westermarck, Jukka; Ventelä, Sami. Cancer cell line microarray as a novel screening method for identification of radioresistance biomarkers in head and neck squamous cell carcinoma. Bmc Cancer. 2021;21(1):868. PubMed |
| López-Cotarelo, Pilar; González-Jiménez, Adela; Agudo-Jiménez, Teresa; Abarca-Zabalía, Judith; Aladro, Yolanda; Pilo, Belén; Comabella, Manuel; Espino-Paisán, Laura; Urcelay, Elena. Genetic variation in NDFIP1 modifies the metabolic patterns in immune cells of multiple sclerosis patients. Scientific Reports. 2021;11(1):21371. PubMed |
| Chen, Muhan; Nowak, Dawid G; Narula, Navneet; Robinson, Brian; Watrud, Kaitlin; Ambrico, Alexandra; Herzka, Tali M; Zeeman, Martha E; Minderer, Matthias; Zheng, Wu; Ebbesen, Saya H; Plafker, Kendra S; Stahlhut, Carlos; Wang, Victoria M Y; Wills, Lorna; Nasar, Abu; Castillo-Martin, Mireia; Cordon-Cardo, Carlos; Wilkinson, John E; Powers, Scott; Sordella, Raffaella; Altorki, Nasser K; Mittal, Vivek; Stiles, Brendon M; Plafker, Scott M; Trotman, Lloyd C. The nuclear transport receptor Importin-11 is a tumor suppressor that maintains PTEN protein. The Journal Of Cell Biology. 2017;216(3):641-656. PubMed |
| Gorla, Madhavi; Santiago, Celine; Chaudhari, Karina; Layman, Awo Akosua Kesewa; Oliver, Paula M; Bashaw, Greg J. Ndfip Proteins Target Robo Receptors for Degradation and Allow Commissural Axons to Cross the Midline in the Developing Spinal Cord. Cell Reports. 2019;26(12):3298-3312.e4. PubMed |
| Xiong, Jian; Luu, Thi Thu Trang; Venkatachalam, Kartik; Du, Guangwei; Zhu, Michael X. Glutamine Produces Ammonium to Tune Lysosomal pH and Regulate Lysosomal Function. Cells. 2022;12(1) PubMed |