Anti NDC80 pAb (ATL-HPA066330)

Atlas Antibodies

SKU:
ATL-HPA066330-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: NDC80 kinetochore complex component
Gene Name: NDC80
Alternative Gene Name: HEC, HEC1, hsNDC80, KNTC2, TID3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024056: 78%, ENSRNOG00000013727: 76%
Entrez Gene ID: 10403
Uniprot ID: O14777
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLKASLQGDVQKYQ
Gene Sequence CYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLKASLQGDVQKYQ
Gene ID - Mouse ENSMUSG00000024056
Gene ID - Rat ENSRNOG00000013727
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NDC80 pAb (ATL-HPA066330)
Datasheet Anti NDC80 pAb (ATL-HPA066330) Datasheet (External Link)
Vendor Page Anti NDC80 pAb (ATL-HPA066330) at Atlas Antibodies

Documents & Links for Anti NDC80 pAb (ATL-HPA066330)
Datasheet Anti NDC80 pAb (ATL-HPA066330) Datasheet (External Link)
Vendor Page Anti NDC80 pAb (ATL-HPA066330)