Anti NDC80 pAb (ATL-HPA066330)

Atlas Antibodies

Catalog No.: ATL-HPA066330-25

Protein Description: NDC80 kinetochore complex component
Gene Name: NDC80
Alternative Gene Name: HEC, HEC1, hsNDC80, KNTC2, TID3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024056: 78%, ENSRNOG00000013727: 76%
Entrez Gene ID: 10403
Uniprot ID: O14777
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLKASLQGDVQKYQ
• Gene Sequence: CYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLKASLQGDVQKYQ
• Gene ID - Mouse: ENSMUSG00000024056
• Gene ID - Rat: ENSRNOG00000013727
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.