Anti NDC1 pAb (ATL-HPA069751)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069751-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NDC1
Alternative Gene Name: FLJ10407, NET3, TMEM48
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028614: 78%, ENSRNOG00000010620: 69%
Entrez Gene ID: 55706
Uniprot ID: Q9BTX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VITQGQYSFLVVPCTGTNSFGSPAAQTCLNEY |
| Gene Sequence | VITQGQYSFLVVPCTGTNSFGSPAAQTCLNEY |
| Gene ID - Mouse | ENSMUSG00000028614 |
| Gene ID - Rat | ENSRNOG00000010620 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NDC1 pAb (ATL-HPA069751) | |
| Datasheet | Anti NDC1 pAb (ATL-HPA069751) Datasheet (External Link) |
| Vendor Page | Anti NDC1 pAb (ATL-HPA069751) at Atlas Antibodies |
| Documents & Links for Anti NDC1 pAb (ATL-HPA069751) | |
| Datasheet | Anti NDC1 pAb (ATL-HPA069751) Datasheet (External Link) |
| Vendor Page | Anti NDC1 pAb (ATL-HPA069751) |