Anti NDC1 pAb (ATL-HPA069751)

Atlas Antibodies

SKU:
ATL-HPA069751-25
  • Immunohistochemical staining of human tonsil shows moderate nuclear positivity in rare non-germinal center cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: NDC1 transmembrane nucleoporin
Gene Name: NDC1
Alternative Gene Name: FLJ10407, NET3, TMEM48
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028614: 78%, ENSRNOG00000010620: 69%
Entrez Gene ID: 55706
Uniprot ID: Q9BTX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VITQGQYSFLVVPCTGTNSFGSPAAQTCLNEY
Gene Sequence VITQGQYSFLVVPCTGTNSFGSPAAQTCLNEY
Gene ID - Mouse ENSMUSG00000028614
Gene ID - Rat ENSRNOG00000010620
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NDC1 pAb (ATL-HPA069751)
Datasheet Anti NDC1 pAb (ATL-HPA069751) Datasheet (External Link)
Vendor Page Anti NDC1 pAb (ATL-HPA069751) at Atlas Antibodies

Documents & Links for Anti NDC1 pAb (ATL-HPA069751)
Datasheet Anti NDC1 pAb (ATL-HPA069751) Datasheet (External Link)
Vendor Page Anti NDC1 pAb (ATL-HPA069751)