Anti NCSTN pAb (ATL-HPA070642)
Atlas Antibodies
- SKU:
- ATL-HPA070642-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: NCSTN
Alternative Gene Name: APH2, KIAA0253
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003458: 91%, ENSRNOG00000005355: 93%
Entrez Gene ID: 23385
Uniprot ID: Q92542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQV |
Gene Sequence | VMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQV |
Gene ID - Mouse | ENSMUSG00000003458 |
Gene ID - Rat | ENSRNOG00000005355 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NCSTN pAb (ATL-HPA070642) | |
Datasheet | Anti NCSTN pAb (ATL-HPA070642) Datasheet (External Link) |
Vendor Page | Anti NCSTN pAb (ATL-HPA070642) at Atlas Antibodies |
Documents & Links for Anti NCSTN pAb (ATL-HPA070642) | |
Datasheet | Anti NCSTN pAb (ATL-HPA070642) Datasheet (External Link) |
Vendor Page | Anti NCSTN pAb (ATL-HPA070642) |