Anti NCSTN pAb (ATL-HPA070642)

Atlas Antibodies

Catalog No.:
ATL-HPA070642-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: nicastrin
Gene Name: NCSTN
Alternative Gene Name: APH2, KIAA0253
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003458: 91%, ENSRNOG00000005355: 93%
Entrez Gene ID: 23385
Uniprot ID: Q92542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQV
Gene Sequence VMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQV
Gene ID - Mouse ENSMUSG00000003458
Gene ID - Rat ENSRNOG00000005355
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NCSTN pAb (ATL-HPA070642)
Datasheet Anti NCSTN pAb (ATL-HPA070642) Datasheet (External Link)
Vendor Page Anti NCSTN pAb (ATL-HPA070642) at Atlas Antibodies

Documents & Links for Anti NCSTN pAb (ATL-HPA070642)
Datasheet Anti NCSTN pAb (ATL-HPA070642) Datasheet (External Link)
Vendor Page Anti NCSTN pAb (ATL-HPA070642)