Anti NCOA4 pAb (ATL-HPA051260)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051260-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: NCOA4
Alternative Gene Name: ARA70, DKFZp762E1112, ELE1, PTC3, RFG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021908: 86%, ENSRNOG00000019768: 86%
Entrez Gene ID: 8031
Uniprot ID: Q13772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQ |
| Gene Sequence | KSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQ |
| Gene ID - Mouse | ENSMUSG00000021908 |
| Gene ID - Rat | ENSRNOG00000019768 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NCOA4 pAb (ATL-HPA051260) | |
| Datasheet | Anti NCOA4 pAb (ATL-HPA051260) Datasheet (External Link) |
| Vendor Page | Anti NCOA4 pAb (ATL-HPA051260) at Atlas Antibodies |
| Documents & Links for Anti NCOA4 pAb (ATL-HPA051260) | |
| Datasheet | Anti NCOA4 pAb (ATL-HPA051260) Datasheet (External Link) |
| Vendor Page | Anti NCOA4 pAb (ATL-HPA051260) |