Anti NCOA4 pAb (ATL-HPA051260)

Atlas Antibodies

Catalog No.:
ATL-HPA051260-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: nuclear receptor coactivator 4
Gene Name: NCOA4
Alternative Gene Name: ARA70, DKFZp762E1112, ELE1, PTC3, RFG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021908: 86%, ENSRNOG00000019768: 86%
Entrez Gene ID: 8031
Uniprot ID: Q13772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQ
Gene Sequence KSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQ
Gene ID - Mouse ENSMUSG00000021908
Gene ID - Rat ENSRNOG00000019768
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NCOA4 pAb (ATL-HPA051260)
Datasheet Anti NCOA4 pAb (ATL-HPA051260) Datasheet (External Link)
Vendor Page Anti NCOA4 pAb (ATL-HPA051260) at Atlas Antibodies

Documents & Links for Anti NCOA4 pAb (ATL-HPA051260)
Datasheet Anti NCOA4 pAb (ATL-HPA051260) Datasheet (External Link)
Vendor Page Anti NCOA4 pAb (ATL-HPA051260)