Anti NCOA2 pAb (ATL-HPA060243)

Atlas Antibodies

Catalog No.:
ATL-HPA060243-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: nuclear receptor coactivator 2
Gene Name: NCOA2
Alternative Gene Name: bHLHe75, GRIP1, KAT13C, NCoA-2, TIF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005886: 94%, ENSRNOG00000007975: 94%
Entrez Gene ID: 10499
Uniprot ID: Q15596
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKLERLDSKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSV
Gene Sequence PKLERLDSKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSV
Gene ID - Mouse ENSMUSG00000005886
Gene ID - Rat ENSRNOG00000007975
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NCOA2 pAb (ATL-HPA060243)
Datasheet Anti NCOA2 pAb (ATL-HPA060243) Datasheet (External Link)
Vendor Page Anti NCOA2 pAb (ATL-HPA060243) at Atlas Antibodies

Documents & Links for Anti NCOA2 pAb (ATL-HPA060243)
Datasheet Anti NCOA2 pAb (ATL-HPA060243) Datasheet (External Link)
Vendor Page Anti NCOA2 pAb (ATL-HPA060243)