Anti NCOA2 pAb (ATL-HPA060243)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060243-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: NCOA2
Alternative Gene Name: bHLHe75, GRIP1, KAT13C, NCoA-2, TIF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005886: 94%, ENSRNOG00000007975: 94%
Entrez Gene ID: 10499
Uniprot ID: Q15596
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PKLERLDSKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSV |
Gene Sequence | PKLERLDSKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSV |
Gene ID - Mouse | ENSMUSG00000005886 |
Gene ID - Rat | ENSRNOG00000007975 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NCOA2 pAb (ATL-HPA060243) | |
Datasheet | Anti NCOA2 pAb (ATL-HPA060243) Datasheet (External Link) |
Vendor Page | Anti NCOA2 pAb (ATL-HPA060243) at Atlas Antibodies |
Documents & Links for Anti NCOA2 pAb (ATL-HPA060243) | |
Datasheet | Anti NCOA2 pAb (ATL-HPA060243) Datasheet (External Link) |
Vendor Page | Anti NCOA2 pAb (ATL-HPA060243) |