Anti NCOA1 pAb (ATL-HPA070213)

Atlas Antibodies

Catalog No.:
ATL-HPA070213-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: nuclear receptor coactivator 1
Gene Name: NCOA1
Alternative Gene Name: bHLHe74, F-SRC-1, KAT13A, NCoA-1, RIP160, SRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020647: 90%, ENSRNOG00000004068: 90%
Entrez Gene ID: 8648
Uniprot ID: Q15788
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLSLDDVKVKVEKKEQMDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAVTSVTIKSEILPAS
Gene Sequence NLSLDDVKVKVEKKEQMDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAVTSVTIKSEILPAS
Gene ID - Mouse ENSMUSG00000020647
Gene ID - Rat ENSRNOG00000004068
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NCOA1 pAb (ATL-HPA070213)
Datasheet Anti NCOA1 pAb (ATL-HPA070213) Datasheet (External Link)
Vendor Page Anti NCOA1 pAb (ATL-HPA070213) at Atlas Antibodies

Documents & Links for Anti NCOA1 pAb (ATL-HPA070213)
Datasheet Anti NCOA1 pAb (ATL-HPA070213) Datasheet (External Link)
Vendor Page Anti NCOA1 pAb (ATL-HPA070213)