Anti NCL pAb (ATL-HPA071110)

Atlas Antibodies

Catalog No.:
ATL-HPA071110-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: nucleolin
Gene Name: NCL
Alternative Gene Name: C23, Nsr1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026234: 83%, ENSRNOG00000018273: 81%
Entrez Gene ID: 4691
Uniprot ID: P19338
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYY
Gene Sequence LEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYY
Gene ID - Mouse ENSMUSG00000026234
Gene ID - Rat ENSRNOG00000018273
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NCL pAb (ATL-HPA071110)
Datasheet Anti NCL pAb (ATL-HPA071110) Datasheet (External Link)
Vendor Page Anti NCL pAb (ATL-HPA071110) at Atlas Antibodies

Documents & Links for Anti NCL pAb (ATL-HPA071110)
Datasheet Anti NCL pAb (ATL-HPA071110) Datasheet (External Link)
Vendor Page Anti NCL pAb (ATL-HPA071110)