Anti NCKIPSD pAb (ATL-HPA050005)

Atlas Antibodies

Catalog No.:
ATL-HPA050005-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: NCK interacting protein with SH3 domain
Gene Name: NCKIPSD
Alternative Gene Name: AF3P21, DIP1, ORF1, SPIN90, WASLBP, WISH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107055: 72%, ENSRNOG00000031816: 69%
Entrez Gene ID: 51517
Uniprot ID: Q9NZQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RKETLSRRGPSASSVAVMTSSTSDHHLDAAAARQPNGVCRAGFERQHSLPSSEHLGADGGLYQIPLPSSQIPPQP
Gene Sequence RKETLSRRGPSASSVAVMTSSTSDHHLDAAAARQPNGVCRAGFERQHSLPSSEHLGADGGLYQIPLPSSQIPPQP
Gene ID - Mouse ENSMUSG00000107055
Gene ID - Rat ENSRNOG00000031816
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NCKIPSD pAb (ATL-HPA050005)
Datasheet Anti NCKIPSD pAb (ATL-HPA050005) Datasheet (External Link)
Vendor Page Anti NCKIPSD pAb (ATL-HPA050005) at Atlas Antibodies

Documents & Links for Anti NCKIPSD pAb (ATL-HPA050005)
Datasheet Anti NCKIPSD pAb (ATL-HPA050005) Datasheet (External Link)
Vendor Page Anti NCKIPSD pAb (ATL-HPA050005)