Anti NCF2 pAb (ATL-HPA006040 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA006040-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: NCF2
Alternative Gene Name: NOXA2, p67phox
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026480: 92%, ENSRNOG00000009286: 39%
Entrez Gene ID: 4688
Uniprot ID: P19878
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGRLFRPNERQVAQLAKKDYLGKATVVASVVDQDSFSGFAPLQPQAA |
| Gene Sequence | MLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGRLFRPNERQVAQLAKKDYLGKATVVASVVDQDSFSGFAPLQPQAA |
| Gene ID - Mouse | ENSMUSG00000026480 |
| Gene ID - Rat | ENSRNOG00000009286 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NCF2 pAb (ATL-HPA006040 w/enhanced validation) | |
| Datasheet | Anti NCF2 pAb (ATL-HPA006040 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NCF2 pAb (ATL-HPA006040 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti NCF2 pAb (ATL-HPA006040 w/enhanced validation) | |
| Datasheet | Anti NCF2 pAb (ATL-HPA006040 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NCF2 pAb (ATL-HPA006040 w/enhanced validation) |
| Citations for Anti NCF2 pAb (ATL-HPA006040 w/enhanced validation) – 2 Found |
| Lomnytska, M I; Becker, S; Bodin, I; Olsson, A; Hellman, K; Hellström, A-C; Mints, M; Hellman, U; Auer, G; Andersson, S. Differential expression of ANXA6, HSP27, PRDX2, NCF2, and TPM4 during uterine cervix carcinogenesis: diagnostic and prognostic value. British Journal Of Cancer. 2011;104(1):110-9. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |