Anti NCCRP1 pAb (ATL-HPA052812)

Atlas Antibodies

Catalog No.:
ATL-HPA052812-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: non-specific cytotoxic cell receptor protein 1 homolog (zebrafish)
Gene Name: NCCRP1
Alternative Gene Name: FBXO50, LOC342897, NCCRP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047586: 77%, ENSRNOG00000054506: 78%
Entrez Gene ID: 342897
Uniprot ID: Q6ZVX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLL
Gene Sequence RNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLL
Gene ID - Mouse ENSMUSG00000047586
Gene ID - Rat ENSRNOG00000054506
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NCCRP1 pAb (ATL-HPA052812)
Datasheet Anti NCCRP1 pAb (ATL-HPA052812) Datasheet (External Link)
Vendor Page Anti NCCRP1 pAb (ATL-HPA052812) at Atlas Antibodies

Documents & Links for Anti NCCRP1 pAb (ATL-HPA052812)
Datasheet Anti NCCRP1 pAb (ATL-HPA052812) Datasheet (External Link)
Vendor Page Anti NCCRP1 pAb (ATL-HPA052812)