Anti NCCRP1 pAb (ATL-HPA052812)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052812-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NCCRP1
Alternative Gene Name: FBXO50, LOC342897, NCCRP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047586: 77%, ENSRNOG00000054506: 78%
Entrez Gene ID: 342897
Uniprot ID: Q6ZVX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLL |
| Gene Sequence | RNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLL |
| Gene ID - Mouse | ENSMUSG00000047586 |
| Gene ID - Rat | ENSRNOG00000054506 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NCCRP1 pAb (ATL-HPA052812) | |
| Datasheet | Anti NCCRP1 pAb (ATL-HPA052812) Datasheet (External Link) |
| Vendor Page | Anti NCCRP1 pAb (ATL-HPA052812) at Atlas Antibodies |
| Documents & Links for Anti NCCRP1 pAb (ATL-HPA052812) | |
| Datasheet | Anti NCCRP1 pAb (ATL-HPA052812) Datasheet (External Link) |
| Vendor Page | Anti NCCRP1 pAb (ATL-HPA052812) |