Anti NCCRP1 pAb (ATL-HPA052812)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052812-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NCCRP1
Alternative Gene Name: FBXO50, LOC342897, NCCRP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047586: 77%, ENSRNOG00000054506: 78%
Entrez Gene ID: 342897
Uniprot ID: Q6ZVX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLL |
Gene Sequence | RNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLL |
Gene ID - Mouse | ENSMUSG00000047586 |
Gene ID - Rat | ENSRNOG00000054506 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NCCRP1 pAb (ATL-HPA052812) | |
Datasheet | Anti NCCRP1 pAb (ATL-HPA052812) Datasheet (External Link) |
Vendor Page | Anti NCCRP1 pAb (ATL-HPA052812) at Atlas Antibodies |
Documents & Links for Anti NCCRP1 pAb (ATL-HPA052812) | |
Datasheet | Anti NCCRP1 pAb (ATL-HPA052812) Datasheet (External Link) |
Vendor Page | Anti NCCRP1 pAb (ATL-HPA052812) |