Anti NCCRP1 pAb (ATL-HPA052812)

Atlas Antibodies

Catalog No.: ATL-HPA052812-25

Protein Description: non-specific cytotoxic cell receptor protein 1 homolog (zebrafish)
Gene Name: NCCRP1
Alternative Gene Name: FBXO50, LOC342897, NCCRP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047586: 77%, ENSRNOG00000054506: 78%
Entrez Gene ID: 342897
Uniprot ID: Q6ZVX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLL
• Gene Sequence: RNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLL
• Gene ID - Mouse: ENSMUSG00000047586
• Gene ID - Rat: ENSRNOG00000054506
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.