Anti NCBP3 pAb (ATL-HPA013195)
Atlas Antibodies
- Catalog No.:
- ATL-HPA013195-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NCBP3
Alternative Gene Name: C17orf85, ELG, HSA277841
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020783: 96%, ENSRNOG00000018550: 96%
Entrez Gene ID: 55421
Uniprot ID: Q53F19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EYPPAHIEWLDDTSCNVVWLDEMTATRALINMSSLPAQDKIRSRDASEDKSAEKRKKDKQEDSSDDDEAEEGEVEDENSSDVELDTLSQVEEESLLRNDLRPANKLAKGN |
| Gene Sequence | EYPPAHIEWLDDTSCNVVWLDEMTATRALINMSSLPAQDKIRSRDASEDKSAEKRKKDKQEDSSDDDEAEEGEVEDENSSDVELDTLSQVEEESLLRNDLRPANKLAKGN |
| Gene ID - Mouse | ENSMUSG00000020783 |
| Gene ID - Rat | ENSRNOG00000018550 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NCBP3 pAb (ATL-HPA013195) | |
| Datasheet | Anti NCBP3 pAb (ATL-HPA013195) Datasheet (External Link) |
| Vendor Page | Anti NCBP3 pAb (ATL-HPA013195) at Atlas Antibodies |
| Documents & Links for Anti NCBP3 pAb (ATL-HPA013195) | |
| Datasheet | Anti NCBP3 pAb (ATL-HPA013195) Datasheet (External Link) |
| Vendor Page | Anti NCBP3 pAb (ATL-HPA013195) |