Anti NCBP3 pAb (ATL-HPA013195)

Atlas Antibodies

Catalog No.:
ATL-HPA013195-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: nuclear cap binding subunit 3
Gene Name: NCBP3
Alternative Gene Name: C17orf85, ELG, HSA277841
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020783: 96%, ENSRNOG00000018550: 96%
Entrez Gene ID: 55421
Uniprot ID: Q53F19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EYPPAHIEWLDDTSCNVVWLDEMTATRALINMSSLPAQDKIRSRDASEDKSAEKRKKDKQEDSSDDDEAEEGEVEDENSSDVELDTLSQVEEESLLRNDLRPANKLAKGN
Gene Sequence EYPPAHIEWLDDTSCNVVWLDEMTATRALINMSSLPAQDKIRSRDASEDKSAEKRKKDKQEDSSDDDEAEEGEVEDENSSDVELDTLSQVEEESLLRNDLRPANKLAKGN
Gene ID - Mouse ENSMUSG00000020783
Gene ID - Rat ENSRNOG00000018550
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NCBP3 pAb (ATL-HPA013195)
Datasheet Anti NCBP3 pAb (ATL-HPA013195) Datasheet (External Link)
Vendor Page Anti NCBP3 pAb (ATL-HPA013195) at Atlas Antibodies

Documents & Links for Anti NCBP3 pAb (ATL-HPA013195)
Datasheet Anti NCBP3 pAb (ATL-HPA013195) Datasheet (External Link)
Vendor Page Anti NCBP3 pAb (ATL-HPA013195)