Anti NCBP3 pAb (ATL-HPA008959)

Atlas Antibodies

Catalog No.: ATL-HPA008959-25

Protein Description: nuclear cap binding subunit 3
Gene Name: NCBP3
Alternative Gene Name: C17orf85, ELG, HSA277841
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020783: 96%, ENSRNOG00000018550: 96%
Entrez Gene ID: 55421
Uniprot ID: Q53F19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRVSVKAEAPAGPALGLPSPEAESGVDRGEPEPMEVEEGELEIVPVRRSLKELIPDTSRRYENKAGSFITGIDVTSKEAIEKKEQRAKRFHFRSEVNLAQRNVALDRDMMKKAIPKVRLETIYICGVD
• Gene Sequence: LRVSVKAEAPAGPALGLPSPEAESGVDRGEPEPMEVEEGELEIVPVRRSLKELIPDTSRRYENKAGSFITGIDVTSKEAIEKKEQRAKRFHFRSEVNLAQRNVALDRDMMKKAIPKVRLETIYICGVD
• Gene ID - Mouse: ENSMUSG00000020783
• Gene ID - Rat: ENSRNOG00000018550
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NCBP3 pAb (ATL-HPA008959) – 2 Found

Gebhardt, Anna; Habjan, Matthias; Benda, Christian; Meiler, Arno; Haas, Darya A; Hein, Marco Y; Mann, Angelika; Mann, Matthias; Habermann, Bianca; Pichlmair, Andreas. mRNA export through an additional cap-binding complex consisting of NCBP1 and NCBP3. Nature Communications. 2015;6( 26382858):8192. 

Gebhardt, Anna; Bergant, Valter; Schnepf, Daniel; Moser, Markus; Meiler, Arno; Togbe, Dieudonnée; Mackowiak, Claire; Reinert, Line S; Paludan, Søren R; Ryffel, Bernhard; Stukalov, Alexey; Staeheli, Peter; Pichlmair, Andreas. The alternative cap-binding complex is required for antiviral defense in vivo. Plos Pathogens. 2019;15(12):e1008155.