Anti NCAPH2 pAb (ATL-HPA069056 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA069056-25
  • Immunohistochemistry analysis in human bone marrow and pancreas tissues using Anti-NCAPH2 antibody. Corresponding NCAPH2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cell junctions.
  • Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NCAPH2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: non-SMC condensin II complex, subunit H2
Gene Name: NCAPH2
Alternative Gene Name: 384D8-2, CAP-H2, hCAP-H2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008690: 81%, ENSRNOG00000009598: 82%
Entrez Gene ID: 29781
Uniprot ID: Q6IBW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDEMEKNNNPLYSRQGEVLASRKDFRMNTCVPHPRGAFMLEPEGMS
Gene Sequence EAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDEMEKNNNPLYSRQGEVLASRKDFRMNTCVPHPRGAFMLEPEGMS
Gene ID - Mouse ENSMUSG00000008690
Gene ID - Rat ENSRNOG00000009598
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti NCAPH2 pAb (ATL-HPA069056 w/enhanced validation)
Datasheet Anti NCAPH2 pAb (ATL-HPA069056 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NCAPH2 pAb (ATL-HPA069056 w/enhanced validation)