Anti NCAPG2 pAb (ATL-HPA049637)

Atlas Antibodies

Catalog No.:
ATL-HPA049637-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: non-SMC condensin II complex subunit G2
Gene Name: NCAPG2
Alternative Gene Name: CAP-G2, FLJ20311, hCAP-G2, LUZP5, MTB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042029: 84%, ENSRNOG00000004968: 85%
Entrez Gene ID: 54892
Uniprot ID: Q86XI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGREKENVTVLDKTLSVNDVACMAGLLEIIVILWKSIDRSMENNKEAKLYTINKFASVLPEYLKVFKDDRCKIPLFMLMSFMPASAVPPFSCGVISTLR
Gene Sequence DGREKENVTVLDKTLSVNDVACMAGLLEIIVILWKSIDRSMENNKEAKLYTINKFASVLPEYLKVFKDDRCKIPLFMLMSFMPASAVPPFSCGVISTLR
Gene ID - Mouse ENSMUSG00000042029
Gene ID - Rat ENSRNOG00000004968
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NCAPG2 pAb (ATL-HPA049637)
Datasheet Anti NCAPG2 pAb (ATL-HPA049637) Datasheet (External Link)
Vendor Page Anti NCAPG2 pAb (ATL-HPA049637) at Atlas Antibodies

Documents & Links for Anti NCAPG2 pAb (ATL-HPA049637)
Datasheet Anti NCAPG2 pAb (ATL-HPA049637) Datasheet (External Link)
Vendor Page Anti NCAPG2 pAb (ATL-HPA049637)