Anti NCAPG2 pAb (ATL-HPA026631)

Atlas Antibodies

Catalog No.: ATL-HPA026631-25

Protein Description: non-SMC condensin II complex, subunit G2
Gene Name: NCAPG2
Alternative Gene Name: CAP-G2, FLJ20311, hCAP-G2, LUZP5, MTB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042029: 69%, ENSRNOG00000004968: 70%
Entrez Gene ID: 54892
Uniprot ID: Q86XI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVGHILELVDNWLPTEHAQAKSNTASKGRVQIHDTRPVKPELALVYIEYLLTHPKNRECLLSAPRKKLNHLLKALETSKADLESLLQTPGGKPRGFSEAAAPRAFGLHCRLSIHLQH
• Gene Sequence: QVGHILELVDNWLPTEHAQAKSNTASKGRVQIHDTRPVKPELALVYIEYLLTHPKNRECLLSAPRKKLNHLLKALETSKADLESLLQTPGGKPRGFSEAAAPRAFGLHCRLSIHLQH
• Gene ID - Mouse: ENSMUSG00000042029
• Gene ID - Rat: ENSRNOG00000004968
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NCAPG2 pAb (ATL-HPA026631) – 3 Found

Zhan, Ping; Xi, Guang-Min; Zhang, Bin; Wu, Ying; Liu, Hong-Bing; Liu, Ya-Fang; Xu, Wu-Jian; Zhu, Qingqing; Cai, Feng; Zhou, Ze-Jun; Miu, Ying-Ying; Wang, Xiao-Xia; Jin, Jia-Jia; Li, Qian; Lv, Tang-Feng; Song, Yong. NCAPG2 promotes tumour proliferation by regulating G2/M phase and associates with poor prognosis in lung adenocarcinoma. Journal Of Cellular And Molecular Medicine. 2017;21(4):665-676. 

Ye, Liang; Wang, Hongying; Li, Huijuan; Liu, Hongbing; Lv, Tangfeng; Song, Yong; Zhang, Fang. Eosinophil peroxidase over-expression predicts the clinical outcome of patients with primary lung adenocarcinoma. Journal Of Cancer. 10(4):1032-1038. 

Yuan, Ling; Li, Jia-Xin; Yang, Yi; Chen, Yan; Ma, Ting-Ting; Liang, Shuang; Bu, Yang; Yu, Lei; Nan, Yi. Depletion of MRPL35 inhibits gastric carcinoma cell proliferation by regulating downstream signaling proteins. World Journal Of Gastroenterology. 2021;27(16):1785-1804.